PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00107.1.g01200.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 264aa    MW: 29158 Da    PI: 6.2873
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00107.1.g01200.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like44.14.7e-145694139
                         G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvk 39
                                    ++rlrWt++LHerFveav+qLGG++k   ++i e++k++
  Zjn_sc00107.1.g01200.1.sm.mkhc 56 RQRLRWTNDLHERFVEAVTQLGGPDKIQASKISEALKLQ 94
                                    58************************9999999988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.91E-55591IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-125593IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-105793IPR006447Myb domain, plants
PfamPF143791.4E-2386130IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MFFFPAEERA MHSTKPEASF GQAHTDSVIN QQQMVLAGND MGPSNGANSN TNMAARQRLR  60
WTNDLHERFV EAVTQLGGPD KIQASKISEA LKLQMEVQKR LHEQLEVQRQ LQLRIEAQGK  120
YLEKIIEEQR RFSGVKPEMP LAGASVTVSS NEQFPDSERT EPSTPAPKSE SPTQGASNRD  180
NGGRTEAPKS PCHDDSLSHH EPLTPDSNHQ PGSPTASPNH ERAAKRQRAS STEFSQGDCS  240
LTGHIFESSS GSEFQQYSMS YSGH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001152613.11e-108MYB-CC type transfactor
TrEMBLB4F7W71e-108B4F7W7_MAIZE; MYB-CC type transfactor
TrEMBLK4JRK41e-108K4JRK4_MAIZE; G2-like transcription factor (Fragment)
STRINGGRMZM2G173943_P021e-108(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-32G2-like family protein